« Zurück
Startseite /
ABflo® 594 Rabbit anti-Mouse CD8a mAb

ABflo® 594 Rabbit anti-Mouse CD8a mAb

43,00 €

Zzgl. MwSt.

ArtNr	A23905-100T
Hersteller	Abclonal
Menge	100 T
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	FC
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	ABflo® 594. Ex:594nm. Em:619nm.
Purity	Affinity purification
Sequence	KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
NCBI	CD8A
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Ly-2; Ly-B; Ly-35; Lyt-2
Lieferbar
Background	Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8a (NP_001074579.1).
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	27KDa
Manufacturers Research Area	Immunology, Adaptive Immunity, T Cells, Cytotoxic Cells
Gene Symbol	CD8A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 T

Listenpreis: 43,00 €

Preis: 43,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen