Comparison

BMAL1 Rabbit pAb

€100.00
Excl. VAT
Item no. A17334-20ul
Manufacturer Abclonal
Amount 20ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence DDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIR
NCBI BMAL1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ARNTL;BMAL1;BMAL1c;JAP3;MOP3;PASD3;TIC;bHLHe5;aryl hydrocarbon receptor nuclear translocator like;IN;LHR;MC56;MDU2;MDU3;MIC4;Pgp1;CDW44;CSPG8;HCELL;HUTCH-I;ECMR-III
Similar products ARNTL, MOP3, bHLHe5, LHR, MDU2, MDU3, MIC4, HUTCH-I, ECMR-III, BMAL1, TIC, BMAL1c, JAP3, PASD3, CDW44, CSPG8, HCELL, IN, MC56, Pgp1, aryl hydrocarbon receptor nuclear translocator like
Available
Background
The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. The protein regulates interferon-stimulated gene expression and is an important factor in viral infection, including COVID-19.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 380-510 of human BMAL1 (NP_001284648.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
69kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Cancer, Endocrine Metabolism, Lipid Metabolism, Cholesterol Metabolism, Neuroscience, Cardiovascular, Blood, Heart, Lipids
Gene Symbol
BMAL1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20ul
Available: In stock
Listprice: €100.00
Price: €100.00
available

Delivery expected until 9/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close