« Zurück
Startseite /
Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein with His tag

Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein with His tag

300,00 €

Zzgl. MwSt.

ArtNr	RP01301LQ-100ug
Hersteller	Abclonal
Menge	100 ug
Kategorie	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Typ	Proteins
Zertifikat	His
Specific against	other
Host	HCoV-OC43
Purity	> 95% by SDS-PAGE.
Dry ice	Yes
Sequence	LGFYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSIFRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMAVYRSLTFVNVPYVYNGSAQATALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCDEYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGNYLAISNELLLTVP
NCBI	HCoV-OC43 Hemagglutinin esterase/HE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Species	HCoV-OC43
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Leu17-Val392
Storage	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturers Research Area	Coronavirus antigens
Gene Symbol	HCoV-OC43 Hemagglutinin esterase/HE
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Protein Description	Recombinant HCoV-OC43 Coronavirus Hemagglutinin esterase Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu17-Val392) of hcov-oc43 Coronavirus Hemagglutinin esterase (Accession #YP_009555240.1) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

Listenpreis: 300,00 €

Preis: 300,00 €

lieferbar

Lieferung vsl. bis 30.09.2025

Anzahl:

Vergleichen