Vergleich

Recombinant SARS-CoV-2 Spike S1 Protein with hFc and His tag

1.975,00 €
Zzgl. MwSt.
ArtNr RP01259-1mg
Hersteller Abclonal
Menge 1 mg
Kategorie
Typ Proteins Recombinant
Specific against SARS-CoV-2
Host SARS-CoV-2
Purity > 90% by SDS-PAGE.
Sequence VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY
NCBI SARS-CoV-2 Spike S1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates thisinteraction.The S protein plays key parts in the induction of neutralizing-antibody and T-cellresponses, as well as protective immunity.
Route
C-hFc&His
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Val11-Arg682
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.|After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.|or This product is stable at ≤ -70°C for up to 6 months from the date of receipt. |For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size
103kDa
Manufacturers Research Area
SARS-CoV-2 antigens
Gene Symbol
SARS-CoV-2 Spike S1
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant SARS-CoV-2(2019-nCoV) Spike S1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val11-Arg682) of SARS-COV-2(2019-nCoV) Spike S1 (Accession #YP_009724390.1) fused with an Fc, 6×His tag at the C-terminus.
Protein Bio Activity
1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ACE2 at 2 μg/mL (100 μL/well) can bind Recombinant SARS-CoV-2 Spike S1, the EC50 of SARS-COV-2 Spike S1 is 6.79 ng/mL.|2.Immobilized Human ACE2 on COOH Chip can bind SARS-COV-2 Spike S1 with an affinity constant of 90.8 nM as determined in a SPR assay (Nicoya OpenSPR).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
Listenpreis: 1.975,00 €
Preis: 1.975,00 €
lieferbar

Lieferung vsl. bis 30.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen