« Back
Home /
Low molecular weight form of human urokinase

Low molecular weight form of human urokinase

€4,545.00

Excl. VAT

Item no.	THP-0021
Manufacturer	Creative BioMart
Amount	1ea
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis
Type	Proteins
Specific against	Hu
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	9039-53-6
Similar products	9039-53-6
Available
Description	The product, that consists of an A chain of 2, 000 daltons linked by a sulfhydryl bond to a B chain of 30, 400 daltons. Recombinant urokinase plasminogen activator.
Formula	C1376H2145N383O406S18
Sequences	KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
CAS No.	9039-53-6
Molecular Weight	31126.5 Da
Synonyms	Kinase (enzyme-activating), uro-urokinase; TCUK; Tissue culture urokinase; Two-chain urokinase; Urochinasi; Urokinase; Urokinasum; Uroquinasa
Applications info	The product can be used for the treatment of pulminary embolism, coronary artery thrombosis, IV catheter clearance, and venous and arterial blood clots.
Examples of Clinical Use	Pulminary embolism, coronary artery thrombosis, IV catheter clearance, and venous and arterial blood clots.
Pharmacodynamics	The product is used for the treatment of pulmonary embolisms. The product consists of an A chain of 2, 000 daltons linked by a sulfhydryl bond to a B chain of 30, 400 daltons. The product is an enzyme (protein) produced by the kidney, and found in the urine. There are two forms which differ in molecular weight but have similar clinical effects. The product is the low molecular weight form. The product acts on the endogenous fibrinolytic system. It converts plasminogen to the enzyme plasmin. Plasmin degrades fibrin clots as well as fibrinogen and some other plasma proteins.
Mechanism of action	Urokinase acts on the endogenous fibrinolytic system. It cleaves the Arg-Val bond in plasminogen to produce active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins.
Affected organisms	Humans and other mammals
Targets	Target 1. Plasminogen; Target 2. Urokinase plasminogen activator surface receptor; Target 3. Urokinase-type plasminogen activator; Target 4. Tissue-type plasminogen activator; Target 5. Plasminogen activator inhibitor 1; Target 6. Plasminogen activator inhibitor 2; Target 7. Plasma serine protease inhibitor; Target 8. Low-density lipoprotein receptor-related protein 2; Target 9. Suppressor of tumorigenicity 14 protein; Target 10. Nidogen-1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1ea

Listprice: €4,545.00

Price: €4,545.00

available

Delivery expected until 10/30/2025

Quantity:

Compare