« Back
Home /
Recombinant Mouse c-Kit/CD117 Protein

Recombinant Mouse c-Kit/CD117 Protein

€59.00

Excl. VAT

Item no.	RP01503-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% by SDS-PAGE.
Sequence	SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLT
NCBI	c-Kit/CD117
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-Kit,CD117,PBT,SCFR
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	This protein is human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	<0.1EU/μg
Immunogen	Ser25-Pro527
Storage	Store the lyophilized protein at -20°C to -80°C for 12 months.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	c-Kit/CD117
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Protein Description	Recombinant Mouse c-Kit/CD117 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser25-Pro527) of mouse KIT/c-KIT/CD117 (Accession #NP_001116205.1) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €59.00

Price: €59.00

available

Delivery expected until 9/30/2025

Quantity:

Compare