« Back
Home /
Recombinant SARS-CoV Spike RBD Protein with His tag

Recombinant SARS-CoV Spike RBD Protein with His tag

€59.00

Excl. VAT

Item no.	RP01299-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	SARS-CoV
Purity	> 95% by SDS-PAGE.
Sequence	RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
NCBI	SARS-CoV Spike RBD
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Species	SARS-CoV
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Arg306-Phe527
Storage	Store the lyophilized protein at -20°C to -80 °C for long term.\|After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.\|or This product is stable at ≤ -70°C for up to 6 months from the date of receipt. \|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturers Research Area	Coronavirus antigens
Gene Symbol	SARS-CoV Spike RBD
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, 300mM NaCl, pH 7.4.or Supplied as a 0.22 μm filtered solution in PBS, 300mM NaCl, pH 7.4.
Protein Description	Recombinant SARS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg306-Phe527) of sars-cov Spike RBD (Accession #NP_828851.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV Spike RBD at 2μg/mL (100μL/well) can bind Human ACE2 (Catalog: RP01275) with a linear range of 0.1-5.18 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €59.00

Price: €59.00

available

Delivery expected until 9/30/2025

Quantity:

Compare