« Back
Home /
Recombinant Human ACE-2 Protein

Recombinant Human ACE-2 Protein

€105.00

Excl. VAT

Item no.	RP01266-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
NCBI	ACE-2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ACE-2,ACEH,ACE2
Available
Description	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His&Avi
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Gln18-Ser740
Storage	Store the lyophilized protein at -20°C to -80 °C for long term.After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.\|or This product is stable at ≤ -70°C for up to 6 months from the date of receipt. \|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Protein Size	86.2kDa
Manufacturers Research Area	SARS-CoV-2 antigens
Gene Symbol	ACE-2
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Active Recombinant Human ACE2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln18-Ser740) of human ACE2 (Accession #Q9BYF1) fused with a 6×His，Avi tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Human ACE2 at 2 μg/mL (100μL/well) can bind SARS-CoV-2 Spike RBD with a linear range of 0.03-4.9 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €105.00

Price: €105.00

available

Delivery expected until 9/30/2025

Quantity:

Compare