« Back
Home /
Recombinant MOUSE PD-1 Protein

Recombinant MOUSE PD-1 Protein

€41.00

Excl. VAT

Item no.	RP01177-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Oncology By Cell Type Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins Myelofibrosis
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
NCBI	PD-1/PDCD1/CD279
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD279, mPD-1, SLEB2, PDCD1, PD1
Similar products	PDCD1, CD279, PD1, SLEB2, mPD-1
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-hFc
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Leu25-Gln167
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	PD-1/PDCD1/CD279
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of mouse PD-1 (Accession #NP_032824.1) fused with an Fc tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €41.00

Price: €41.00

available

Delivery expected until 9/2/2025

Quantity:

Compare