« Back
Home /
Recombinant Mouse IL-17A Protein

Recombinant Mouse IL-17A Protein

€290.00

Excl. VAT

Item no.	RP01121-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
Sequence	TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
NCBI	IL-17A
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, _+E_CTLA8, IL17
Similar products	IL-17, IL17A, IL-17A, IL17, Interleukin-17A, CTLA-8, Cytotoxic T-Lymphocyte-Associated Antigen 8, _+E_CTLA8
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	This protein is a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Immunogen	Thr22-Ala158
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Interleukin
Gene Symbol	IL-17A
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse IL-17A Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Thr22-Ala158) of mouse IL-17A (Accession #Q62386) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €290.00

Price: €290.00

available

Delivery expected until 9/30/2025

Quantity:

Compare