« Back
Home /
Recombinant Human Ephrin A3 Protein

Recombinant Human Ephrin A3 Protein

€37.00

Excl. VAT

Item no.	RP01022-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Stem Cell Markers
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
NCBI	Ephrin-A3/EFNA3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	EFL2, Ehk1-L, EPLG3, LERK3
Similar products	EFL2, EPLG3, Ehk1-L, LERK3
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-hFc&His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Met1-Ser213
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Ephrin-A3/EFNA3
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Ephrin-A3/EFNA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Ser 213) of human Ephrin A3 (Accession #NP_004943.1) fused with an Fc, 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Mouse EPHA6 at 1 μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0.3-113.9 ng/mL.\|2.Measured by its binding ability in a functional ELISA.Immobilized Mouse EPHA6 at 1μg/mL (100 μL/well) can bind Human EphrinA3 with a linear range of 0.3-59 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €37.00

Price: €37.00

available

Delivery expected until 9/2/2025

Quantity:

Compare