Comparison

Recombinant Mouse IgG2A Fc Protein

€26.00
Excl. VAT
Item no. RP00802-10ug
Manufacturer Abclonal
Amount 10 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
NCBI IgG2A Fc
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Ig gamma-2 chain C region,IgG2A Fc
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotypethat can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, andconstitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens byagglutination and immobilization, complement activation, toxin neutralization, as well as the antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (50 kDa ) and two light chains (25 kDa) linked bydisulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fabfragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum amongthe four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcγR ) on phagocytic cells with high affinity. Fc fragmentis demonstrated to mediate phagocytosis, trigger inflammation, and target Ig to particular tissues. Protein G or Protein A onthe surface of certain Staphylococcal and Streptococcal strains specifically binds with the Fc region of IgGs, and hasnumerous applications in biotechnology as a reagent for affinity purification. Recombinant IgG Fc Region is suggested torepresent a potential anti-inflammatory drug for treatment of human autoimmune diseases.
Route
No tag
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Pro99-Lys330
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Fc & Fc receptor
Gene Symbol
IgG2A Fc
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Mouse IgG2A Fc Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Pro99-Lys330) of mouse IgG2A Fc (Accession #P01863).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
Listprice: €26.00
Price: €26.00
available

Delivery expected until 9/2/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close