Comparison

Recombinant Rat B7-2/CD86 Protein

€59.00
Excl. VAT
Item no. RP00733-10ug
Manufacturer Abclonal
Amount 10 ug
Category
Type Proteins Recombinant
Specific against Rat (Rattus norvegicus)
Purity > 95% by SDS-PAGE.
Sequence VPVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRK
NCBI B7-2/CD86
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias T-lymphocyte activation antigen CD86; Activation B7-2 antigen; CD86
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members aretransmembrane cell surface molecules that play important roles in immune activation and the maintenance ofimmune tolerance. It is highly expressed on activated antigen presenting cells. CD86 involved in thecostimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 orCTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, suchas deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It isexpressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosisand lysosomal degradation.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Val29-Lys247
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint
Gene Symbol
B7-2/CD86
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Rat B7-2/CD86 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val29-Lys247) of rat B7-2/CD86 (Accession #O35531) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
Listprice: €59.00
Price: €59.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close