Recombinant Mouse LAG-3/CD223 Protein

€405.00
Excl. VAT
Item no. RP00678-50ug
Manufacturer Abclonal
Amount 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence SGPGKELPVVWAQEGAPVHLPCSLKSPNLDPNFLRRGGVIWQHQPDSGQPTPIPALDLHQGMPSPRQPAPGRYTVLSVAPGGLRSGRQPLHPHVQLEERGLQRGDFSLWLRPALRTDAGEYHATVRLPNRALSCSLRLRVGQASMIASPSGVLKLSDWVLLNCSFSRPDRPVSVHWFQGQNRVPVYNSPRHFLAETFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVLGLEPVAPLTVYAAEGSRVELPCH
NCBI LAG-3/CD223
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias LAG3,CD223,FDC,Ly66,LAG3
Available
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
Lymphocyte-activation gene 3 (LAG3), also known as CD223, is a type I transmembrane protein with fourextracellular Ig-like domains, designated D1 to D4 and belongs to the immunoglobulin superfamily. The genefor LAG3 lies adjacent to the gene for CD4 on human chromosome 12p13.32 and shares approximately 20%identical to the CD4 gene. LAG3 is expressed on activated T cells, natural killer cells, B cells and plasmacytoiddendritic cells. LAG3 binds with high affinity to MHC class II molecules, and it interferes competitively with thebinding of CD4 to MHC class II and thereby blocks the transduction of stimulatory signals mediated by thisinteraction. LAG3 negatively regulates cellular proliferation, activation, and homeostasis of T cells, and plays animportant role in Treg suppressive function. LAG3 is the target of various drug development programs todevelop new treatments for cancer and autoimmune disorders. The soluble form, sLAG-3, is being developedas a cancer drug.
Route
C-6×His
Manufacturers Category
Proteins
Endotoxin
< 1 EU/μg of the protein by LAL method.
Immunogen
Ser23-Leu442
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Immune Checkpoint, Bio-Markers & CD Antigens
Gene Symbol
LAG-3/CD223
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Mouse LAG-3/CD223 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Ser23-Leu442) of mouse LAG-3/CD223 (Accession #Q61790) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
Listprice: €405.00
Price: €405.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close