« Back
Home /
Recombinant Human LAG-3/CD223 Protein

Recombinant Human LAG-3/CD223 Protein

€70.00

Excl. VAT

Item no.	RP00657-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSR
NCBI	LAG-3/CD223
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	LAG3,CD223
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	Human Lymphocyte activation gene 3 protein( LAG3) is a member of immunoglobulin (Ig) superfamily. LAG3contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. LAG3 is involved in lymphocyteactivation and can bind to HLA class-II antigens. It is selectively expressed in activated T and NK cells. LAG3 hasa negative regulatory function in T cells and acts as as a new marker of T cell induced B cell activation. As asoluble molecule, LAG3 activates antigen-presenting cells through MHC class II signaling. It can lead toincreased antigen-specific T-cell responses in vivo. LAG-3 has higher affinity to MHC class II than CD4.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Leu23-Gly434
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	LAG-3/CD223
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human LAG-3/CD223 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Leu23-Gly434) of human LAG-3/CD223 (Accession #P18627) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €70.00

Price: €70.00

available

Delivery expected until 9/30/2025

Quantity:

Compare