« Back
Home /
Recombinant Mouse CD28/TP44 Protein

Recombinant Mouse CD28/TP44 Protein

€26.00

Excl. VAT

Item no.	RP00638-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% by SDS-PAGE.
Sequence	NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPK
NCBI	CD28/TP44
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD28,Tp44,CD28
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	T-cell-specific surface glycoprotein CD28, contains an Ig-like V-type domain. CD28 is one of the proteinsexpressed on T cells that provide co-stimulatory signals, which are required for their activation. It is thereceptor for CD80 and CD86. When activated by Toll-like receptor ligands, the CD80 expression is upregulatedin antigen presenting cells (APCs). The CD86 expression on antigen presenting cells is constitutive. CD28 is theonly B7 receptor constitutively expressed on naive T cells. It involved in T-cell activation, the induction of cellproliferation and cytokine production and promotion of T-cell survival.
Route	C-Fc & 6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Asn20-Lys149
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint
Gene Symbol	CD28/TP44
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse CD28/TP44 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Asn20-Lys149) of mouse CD28/TP44 (Accession #P31041) fused with an Fc, 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €26.00

Price: €26.00

available

Delivery expected until 9/30/2025

Quantity:

Compare