« Back
Home /
Recombinant Human Apolipoprotein E/ApoE Protein

Recombinant Human Apolipoprotein E/ApoE Protein

€37.00

Excl. VAT

Item no.	RP00306-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins Obesity Lipid & Fatty Acid Transport
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAE
NCBI	Apolipoprotein E/ApoE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AD2, APO-E, ApoE4, LDLCQ5, LPG
Similar products	ApoE4, AD2, LDLCQ5, LPG, APO-E
Available
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	This protein is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Route	C-6×His
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Lys19-His317
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Apolipoprotein E/ApoE
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Apolipoprotein E/ApoE Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Lys19-His317) of human Apolipoprotein E/ApoE (Accession #P02649) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €37.00

Price: €37.00

available

Delivery expected until 9/2/2025

Quantity:

Compare