« Back
Home /
Recombinant Human Osteoprotegerin/TNFRSF11B Protein

Recombinant Human Osteoprotegerin/TNFRSF11B Protein

€41.00

Excl. VAT

Item no.	RP00180-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDL
NCBI	TNFRSF11B/Osteoprotegerin
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Osteoprotegerin or TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Glu22-Leu401
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	TNF family
Gene Symbol	TNFRSF11B/Osteoprotegerin
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession #NP_002537.3) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant human TNFRSF11B at 2 μg/mL (100 μL/well) can bind Recombinant human TNFSF11 with a linear range of 2-8 ng/mL.\|2.Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED₅₀ for this effect is 28.5-114 pg/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €41.00

Price: €41.00

available

Delivery expected until 9/2/2025

Quantity:

Compare