« Back
Home /
Active Recombinant Human c-Kit ligand/SCF/KITLG Protein

Active Recombinant Human c-Kit ligand/SCF/KITLG Protein

€59.00

Excl. VAT

Item no.	RP00124-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 97% by SDS-PAGE.
Sequence	EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH
NCBI	c-Kit ligand/SCF/KITLG
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DCUA;DFNA69;FPH2;FPHH;Kitl;KL-1;MGF;SCF;SF;SHEP7
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	The protein is tyrosine-kinase receptor. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Glu26-His214
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Cytokines & Cytokine receptors, Cell Culture related
Gene Symbol	c-Kit ligand/SCF/KITLG
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human c-Kit ligand/SCF/KITLG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-His214) of human SCF/C-kit ligand (Accession #NP_000890.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	1.Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED₅₀ for this effect is 0.08-0.3 ng/mL.\|2.Measured by its binding ability in a functional ELISA. Immobilized recombinant human SCF at 1 μg/mL (100 μL/well) can bind recombinant human CD117 with a linear range of 1-6 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €59.00

Price: €59.00

available

Delivery expected until 9/30/2025

Quantity:

Compare