« Back
Home /
Recombinant Human Galectin-3 Protein

Recombinant Human Galectin-3 Protein

€41.00

Excl. VAT

Item no.	RP00057-10ug
Manufacturer	Abclonal
Amount	10 ug
Category	Oncology Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Obesity Lipid & Fatty Acid Transport By Organ Skin Cancer Hepatic Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
NCBI	Galectin-3/LGALS3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2
Similar products	LGALS2, MAC2, GALBP, GAL3, CBP35, GALIG, L31
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	This protein is a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Ala2-Ile250
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Galectin-3/LGALS3
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Galectin-3/LGALS3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Ile250) of human Galectin-3 (Accession #NP_002297.2).
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Human Galectin-3 at 1 μg/mL (100 μL/well) can bind Galectin-3/LGALS3 Rabbit mAb with a linear range of 0.24-35 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

Listprice: €41.00

Price: €41.00

available

Delivery expected until 9/2/2025

Quantity:

Compare