« Back
Home /
BMPG Recombinant Protein

BMPG Recombinant Protein

€891.00

Excl. VAT

Item no.	PRS-91-647-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Food Safety Histamines Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins By Organ Bone Cancer Astrocyte Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Dry ice	Yes
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bone Marrow Proteoglycan, BMPG, Proteoglycan 2, Eosinophil Granule Major Basic Protein, EMBP, MBP, Pregnancy-Associated Major Basic Protein, PRG2
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Supplied as a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions	Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	24.6 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Bone Marrow Proteoglycan (BMPG) is a secreted protein that contains one C-type lectin domain. BMPG is the predominant constituent of the crystalline core of the eosinophil granule. BMPG is highly expressed in placenta and pregnancy serum. BMPG may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin. BMPG induces non-cytolytic histamine release from human basophils. In addition, BMPG also participated in antiparasitic defense mechanisms and immune hypersensitivity reactions.
Accession #	P13727
Ncbi Gene Id #	5553
Ncbi Official Symbol	PRG2
Ncbi Official Full Name	proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
Ncbi Organism	Homo sapiens
Swissprot #	P13727
Fusion Tag	C-6 His tag
Sequence	Leu17-Tyr222
Protein Gi#	189054143
Peptide Sequence	LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSYVDHHHHHH

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

Listprice: €891.00

Price: €891.00

available

Delivery expected until 10/2/2025

Quantity:

Compare