« Back
Home /
Bc1-w Recombinant Protein

Bc1-w Recombinant Protein

€613.00

Excl. VAT

Item no.	PRS-91-088-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Food Safety Drugs By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Autophagy Cardiovascular Research Ischemia & Reperfusion Injury By Organ Colorectal Cancer Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Dry ice	Yes
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bcl-2-Like Protein 2, Bcl2-L-2, Apoptosis Regulator Bcl-W, BCL2L2, BCLW, KIAA0271, Bcl-2-Llike Protein 2
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Supplied as a 0.2 um filtered solution of 25mM HEPES, 100mM KCl, 20% Glycerol, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions	Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	19.87 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Bcl-2-like protein 2 (BCL2L2) belongs to the Bcl-2 family. BCL2L2 is highly expressed in thebrain, spinal cord, testis, pancreas, heart, spleen, and mammary glands. BCL2L2 is a peripheral membrane protein containing three motifs, BH1, BH2 and BH4. The BH4 motif appears to be involved in the anti-apoptotic function. The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. BCL2L2 promotes cell survival and blocks dexamethasone-induced apoptosis. Furthermore, BCL2L2 mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.
Accession #	Q92843
Ncbi Gene Id #	599
Ncbi Official Symbol	BCL2L2
Ncbi Official Full Name	BCL2 like 2
Ncbi Organism	Homo sapiens
Swissprot #	Q92843
Fusion Tag	C-6 His tag
Sequence	Ala2-Thr172
Peptide Sequence	ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTLEHHHHHH

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

Listprice: €613.00

Price: €613.00

available

Delivery expected until 9/4/2025

Quantity:

Compare