« Back
Home /
Recombinant Dog Glycoprotein hormones alpha chain(CGA)

Recombinant Dog Glycoprotein hormones alpha chain(CGA)

€2,128.00

Excl. VAT

Item no.	CSB-YP895474DO-1mg
Manufacturer	Cusabio
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Canine
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Anterior pituitary glycoprotein hormones common subunit alpha;Follicle-stimulating hormone alpha chain;FSH-alpha;Follitropin alpha chain;Luteinizing hormone alpha chain;LSH-alpha;Lutropin alpha chain;Thyroid-stimulating hormone alpha chain;TSH-alpha;Thyro
Available
Gene Names	CGA
Expression Region	25-120aa
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 10xHis-tagged
AASequence	FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS
MW	12.7 kDa
Endotoxin	Not test.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance	Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

Listprice: €2,128.00

Price: €2,128.00

available

Quantity:

Compare

Add to wishlist