« Back
Home /
Recombinant Human Integrin alpha-IIb(ITGA2B),partial

Recombinant Human Integrin alpha-IIb(ITGA2B),partial

€231.00

Excl. VAT

Item no.	CSB-YP011865HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cardiovascular
Uniprot ID	P08514
Gene Names	ITGA2B
Organism	Homo sapiens (Human)
AA Sequence	CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGE GAYEAELAVHLPQGAHYMRALSNVEGFERLICNQK KENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEE AGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQ VELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEH TYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILD IQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPA HHKR
Expression Region	639-887aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	29 kDa
Alternative Name(s)	GPalpha IIb ; GPIIbPlatelet membrane glycoprotein IIb; CD41
Relevance	Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Reference	Structure of the platelet membrane glycoprotein IIb. Homology to the alpha subunits of the vitronectin and fibronectin membrane receptors.Poncz M., Eisman R., Heidenreich R., Silver S.M., Vilaire G., Surrey S., Schwartz E., Bennett J.S.J. Biol. Chem. 262:8476-8482(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.
Involvement in disease	Glanzmann thrombasthenia (GT); Bleeding disorder, platelet-type 16 (BDPLT16)
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	Integrin alpha chain family
Tissue Specificity	Isoform 1 and isoform 2 are expressed in platelets and megakaryocytes, but not in reticulocytes. Not detected in Jurkat, nor in U937 cell lines (PubMed:2351656). Isoform 3 is expressed in prostate adenocarcinoma, as well as in several erythroleukemia, prostate adenocarcinoma and melanoma cell lines, including PC-3, DU-145, HEL, WM983A, WM983B and WM35. Not detected in platelets, nor in normal prostate (at protein level) (PubMed:9809974).
Paythway	PI3K-Aktsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

Listprice: €231.00

Price: €231.00

available

Quantity:

Compare

Add to wishlist