« Back
Home /
Recombinant Human Urokinase-type plasminogen activator(PLAU),partial

Recombinant Human Urokinase-type plasminogen activator(PLAU),partial

€213.00

Excl. VAT

Item no.	CSB-RP143194h(A4)-20
Manufacturer	Cusabio
Amount	20ug
Category	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cardiovascular
Uniprot ID	P00749
Gene Names	PLAU
Organism	Homo sapiens (Human)
AA Sequence	SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPK KFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRP CLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNP DNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSP PEELKFQCGQKTL
Expression Region	21-173aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	21.3 kDa
Relevance	Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Reference	Complete sequencing and characterization of 21, 243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Involvement in disease	Quebec platelet disorder (QPD)
Subcellular Location	Secreted
Protein Families	Peptidase S1 family
Tissue Specificity	Expressed in the prostate gland and prostate cancers.
Paythway	NF-kappaBsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

Listprice: €213.00

Price: €213.00

available

Quantity:

Compare

Add to wishlist