« Back
Home /
Recombinant Human Interleukin-8 (CXCL8), partial (Active)

Recombinant Human Interleukin-8 (CXCL8), partial (Active)

Item no.	BM-RPC26907-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-8, IL-8, C-X-C Motif Chemokine 8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, Monocyte-Derived Neutrophil Chemotactic Factor, MDNCF, Monocyte-Derived Neutrophil-Activating Peptide, MONAP, Neutrophil-Activating Protein 1, NAP-1, Protei
Similar products	IL-8, IL8, Interleukin-8, CXCL8, GCP-1, Emoctakin, MDNCF, MONAP, NAP-1, Protein 3-10C, Neutrophil-Activating Protein 1, Granulocyte Chemotactic Protein 1, C-X-C Motif Chemokine 8, Monocyte-Derived Neutrophil Chemotactic Factor, Monocyte-Derived Neutrophil-Activating Peptide, T-Cell Chemotactic Factor
Available
Gene Name	CXCL8
Alternative Names	Interleukin-8, IL-8, C-X-C Motif Chemokine 8, Emoctakin, Granulocyte Chemotactic Protein 1, GCP-1, Monocyte-Derived Neutrophil Chemotactic Factor, MDNCF, Monocyte-Derived Neutrophil-Activating Peptide, MONAP, Neutrophil-Activating Protein 1, NAP-1, Protein 3-10C, T-Cell Chemotactic Factor, IL8, CXCL8
Uniprot	P10145
Source	E.coli
Expression Region	28-99aa
AA Sequence	SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCA NTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAE NS
Sequence Info	Partial
Tag Info	Tag-Free
Theoretical MW	8.45 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 5 ng/mL.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 10-15-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/25/2025

Compare

Add to wishlist

Get an offer

Request delivery time