« Back
Home /
ACTH (1-39) (human)

ACTH (1-39) (human)

€242.00

Excl. VAT

Item no.	EP10644_1
Manufacturer	peptides & elephants
Amount	5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Adrenocorticotropic Hormone (18-39), Corticotropin-like Intermediate Lobe Peptide
Available
Description	Major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.
Keywords	Adrenocorticotropic Hormone (18-39), Corticotropin-like Intermediate Lobe Peptide
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
N-Terminus	H
C-Terminus	OH
Purity	0, 95
Counter-Ion	TFA
Storage	Store dry at -20°C

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5 mg

Listprice: €242.00

Price: €242.00

available

Delivery expected until 10/16/2025

Quantity:

Compare