Comparison

Recombinant Mouse Interleukin-13/IL-13 (Ser26-Phe131,C-6His)

Item no. CD57-1mg
Manufacturer Bon Opus
Amount 1mg
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag His
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVD LAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNR KAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGP FVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13
Similar products IL-13
Available
Background
Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation & immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein & exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) & activates STAT-6. IL13 initially binds IL-13Ralpha1 with low affinity & triggers association of IL4Ralpha, generating a high affinity heterodimeric receptor IL13R & eliciting downstream signals. IL13 also binds IL-13Ralpha2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation & disease.
Description
Recombinant Mouse Interleukin-13 is produced by our Mammalian expression system & the target gene encoding Ser26-Phe131 is expressed with a 6His tag at the C-terminus.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Molecular Weight
12, 7
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length
Ser26-Phe131
Ship Description
The product is shipped at ambient temperature.
Storage
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close