« Back
Home /
PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat

€142.00

Excl. VAT

Item no.	RP10335-0.5
Manufacturer	GenScript
Amount	0,5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Peptides By Organ Lung Cancer
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 ; {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10335-PACAP_1-38, PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.</td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> PACAP stimulates adenylate cyclase in rat anterior pituitary cells.</td></tr>
Similar products	PACAP
Available
C-Terminal	NH2
Description	PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.
Notes	PACAP stimulates adenylate cyclase in rat anterior pituitary cells.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Storage	Store the peptide at -20C.
Manufacturers Category	Peptides & Chemicals
Manufacturers Product Line	Other Peptides
Product Origin	USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0,5 mg

Listprice: €142.00

Price: €142.00

available

Delivery expected until 9/4/2025

Quantity:

Compare