« Back
Home /
β-Amyloid (1-40)

β-Amyloid (1-40)

€190.00

Excl. VAT

Item no.	RP10004-1
Manufacturer	GenScript
Amount	1 mg
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding By Cell Type Peptides & Proteins Adenocarcinoma Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ; {ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10004-beta-Amyloid_1-40_beta-APP, Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region. </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water, may be dissolved in any buffer of pH >9. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr><tr><th>Notes</th><td colspan="7"> In culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.</td></tr>
Similar products	beta-Amyloid
Available
Description	Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
Notes	In culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.
Solubility	Insoluble in water, may be dissolved in any buffer of pH >9.
Storage	Store at -20C
Manufacturers Category	Peptides & Chemicals
Manufacturers Product Line	Amyloid Peptides
Product Origin	USA

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP10004-1-datasheet.pdf

RP10004-1-safety-datasheet.pdf