« Back
Home /
Recombinant Human KeRatin, type I cytoskeletal 14(KRT14)

Recombinant Human KeRatin, type I cytoskeletal 14(KRT14)

Item no.	CSB-YP012512HU-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokeratin-14 ;CK-14Keratin-14 ;K14
Available
Research Topic	Signal Transduction
Uniprot ID	P02533
Gene Names	KRT14
Organism	Homo sapiens (Human)
AA Sequence	MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVL AGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYG GGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFA GGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEAN ADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNK ILTATVDNANVLLQIDNARLAADDFRTKYETELNL RMSVEADINGLRRVLDELTLARADLEMQIESLKEE LAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDL SRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNR EVATNSELVQSGKSEISELRRTMQNLEIELQSQLS MKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLA QLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLE GEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDV HDGKVVSTHEQVLRTKN
Expression Region	1-472aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	53.6 kDa
Alternative Name(s)	Cytokeratin-14 ; CK-14Keratin-14 ; K14
Relevance	The nonhelical tail domain is involved in promoting KRT5-KRT14 filaments to self-organize into large bundles and enhances the mechanical properties involved in resilience of keratin intermediate filaments in vitro.
Reference	Remarkable conservation of structure among intermediate filament genes.Marchuk D., McCrohon S., Fuchs E.Cell 39:491-498(1984)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The nonhelical tail domain is involved in promoting KRT5-KRT14 filaments to self-organize into large bundles and enhances the mechanical properties involved in resilience of keratin intermediate filaments in vitro.
Involvement in disease	Epidermolysis bullosa simplex, Dowling-Meara type (DM-EBS); Epidermolysis bullosa simplex, Weber-Cockayne type (WC-EBS); Epidermolysis bullosa simplex, Koebner type (K-EBS); Epidermolysis bullosa simplex, autosomal recessive 1 (EBSB1); Naegeli-Franceschetti-Jadassohn syndrome (NFJS); Dermatopathia pigmentosa reticularis (DPR)
Subcellular Location	Cytoplasm, Nucleus
Protein Families	Intermediate filament family
Tissue Specificity	Detected in the basal layer, lowered within the more apically located layers specifically in the stratum spinosum, stratum granulosum but is not detected in stratum corneum. Strongly expressed in the outer root sheath of anagen follicles but not in the germinative matrix, inner root sheath or hair. Found in keratinocytes surrounding the club hair during telogen.
Paythway	Estrogensignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP012512HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question