« Back
Home /
Recombinant Human Interleukin-8(CXCL8),partial

Recombinant Human Interleukin-8(CXCL8),partial

€965.00

Excl. VAT

Item no.	CSB-YP011671HU-500
Manufacturer	Cusabio
Amount	500ug
Category	Neuroscience Neuroinflammation Metabolism Diabetes Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Immunology
Uniprot ID	P10145
Gene Names	CXCL8
Organism	Homo sapiens (Human)
AA Sequence	AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIES GPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF LKRAENS
Expression Region	23-99aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	10.9 kDa
Alternative Name(s)	C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 Short name: GCP-1 Monocyte-derived neutrophil chemotactic factor Short name: MDNCF Monocyte-derived neutrophil-activating peptide Short name: MONAP Neutrophil-activating protein 1 Short name: NAP-1 Protein 3-10C T-cell chemotactic factor IL8
Relevance	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Reference	Induction of mRNA for a serine protease and a beta-thromboglobulin-like protein in mitogen-stimulated human leukocytes. Schmid J., Weissmann C. J. Immunol. 139:250-256(1987)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Subcellular Location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

Listprice: €965.00

Price: €965.00

available

Quantity:

Compare

Add to wishlist