« Back
Home /
Recombinant Human CD70 antigen(CD70),partial

Recombinant Human CD70 antigen(CD70),partial

€385.00

Excl. VAT

Item no.	CSB-YP004954HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD27 ligand ;CD27-LTumor necrosis factor ligand superfamily member 7; CD70
Available
Research Areas	Cancer
Uniprot ID	P32970
Gene Names	CD70
Organism	Homo sapiens (Human)
AA Sequence	QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRL YWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHI QVTLAICSSTTASRHHPTTLAVGICSPASRSISLL RLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPS RNTDETFFGVQWVRP
Expression Region	39-193
Sequence Info	Extracellular Domain
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	19.1 kDa
Alternative Name(s)	CD27 ligand ; CD27-LTumor necrosis factor ligand superfamily member 7; CD70
Relevance	Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Reference	Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor.Goodwin R.G., Alderson M.R., Smith C.A., Armitage R.J., Vandenbos T., Jerzy R., Tough T.W., Schoenborn M.A., David-Smith T., Hennen K., Falk B., Cosman D., Baker E., Sutherland G.R., Grabstein K.H., Farrah T., Giri J.G., Beckmann M.P.Cell 73:447-456(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Subcellular Location	Membrane, Single-pass type II membrane protein
Protein Families	Tumor necrosis factor family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

Listprice: €385.00

Price: €385.00

available

Quantity:

Compare

Add to wishlist