« Back
Home /
Recombinant Human Heat shock factor-binding protein 1(HSBP1),partial

Recombinant Human Heat shock factor-binding protein 1(HSBP1),partial

€350.00

Excl. VAT

Item no.	CSB-RP004544h-100
Manufacturer	Cusabio
Amount	100ug
Category	Oncology Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins By Organ Head & Neck Cancer
Type	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nasopharyngeal carcinoma-associated antigen 13 ;NPC-A-13
Available
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	O75506
Gene Names	HSBP1
Organism	Homo sapiens (Human)
AA Sequence	MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQII GRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI PATQK
Expression Region	1-75aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	35.5 kDa
Alternative Name(s)	Nasopharyngeal carcinoma-associated antigen 13 ; NPC-A-13
Relevance	Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.
Reference	A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.
Subcellular Location	Nucleus
Protein Families	HSBP1 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

Listprice: €350.00

Price: €350.00

available

Quantity:

Compare

Add to wishlist