« Back
Home /
Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)

Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)

€1,783.00

Excl. VAT

Item no.	CSB-EP510513KBG-1
Manufacturer	Cusabio
Amount	1mg
Category	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Metallo-beta-lactamase NDM-1
Available
Research Areas	Others
Target / Protein	blaNDM-1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Klebsiella pneumoniae
Uniprot ID	C7C422
AA Sequence	GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTS YLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQT AQILNWIKQEINLPVALAVVTHAHQDKMGGMDALH AAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW VEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDI AFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGA AFPKASMIVMSHSAPDSRAAITHTARMADKLR
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	29-270aa
Protein Length	Full Length of Mature Protein
MW	41.6 kDa
Alternative Name(s)	Metallo-beta-lactamase NDM-1
Relevance	Confers resistance to many beta-lactam antibiotics, including some carbapens. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Reference	Characterization of a new metallo-beta-lactamase gene, bla(NDM-1), and a novel erythromycin esterase gene carried on a unique genetic structure in Klebsiella pneumoniae sequence type 14 from India.Yong D., Toleman M.A., Giske C.G., Cho H.S., Sundman K., Lee K., Walsh T.R.Antimicrob. Agents Chemother. 53:5046-5054(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Subcellular Location	Periplasm
Protein Families	Metallo-beta-lactamase superfamily, Class-B beta-lactamase family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP510513KBG-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

Listprice: €1,783.00

Price: €1,783.00

available

Quantity:

Compare

Add to wishlist