Recombinant Mouse Complement C3(C3),partial

Others

Not Test

Mus musculus (Mouse)

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSK VTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICT KYLGDVDATMSILDISMMTGFAPDTKDLELLASGV DRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLT FKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHP EKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLN VRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTI QQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGK KYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAE ECQDQKYQKQCEELGAFTESMVVYGCPN

1321-1663aa

55.3 kDa

C3 plays a central role in the activation of the complent syst. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils . It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity.C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation.Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.

Greater than 90% as determined by SDS-PAGE.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; FUNCTION