« Back
Home /
Recombinant Human Vimentin(VIM)

Recombinant Human Vimentin(VIM)

€1,325.00

Excl. VAT

Item no.	CSB-EP025857HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins Stem Cell Markers
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cancer
Target / Protein	VIM
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P08670
AA Sequence	STRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTR TYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLR SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVE LQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQ GKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERD NLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVD NASLARLDLERKVESLQEEIAFLKKLHEEEIQELQ AQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAA KNLQEAEEWYKSKFADLSEAANRNNDALRQAKQES TEYRRQVQSLTCEVDALKGTNESLERQMREMEENF AVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL LNVKMALDIEIATYRKLLEGEESRISLPLPNFSSL NLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVIN ETSQHHDDLE
Tag Info	N-terminal 6xHis-tagged
Expression Region	2-466aa
Protein Length	Full Length of Mature Protein
MW	57.5 kDa
Relevance	Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.
Reference	Coding sequence and growth regulation of the human vimentin gene.Ferrari S., Battini R., Kaczmarek L., Rittling S., Calabretta B., de Riel J.K., Philiponis V., Wei J.-F., Baserga R.Mol. Cell. Biol. 6:3614-3620(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.
Involvement in disease	Cataract 30, multiple types (CTRCT30)
Subcellular Location	Cytoplasm
Protein Families	Intermediate filament family
Tissue Specificity	Highly expressed in fibroblasts, some expression in T- and B-lymphocytes, and little or no expression in Burkitt's lymphoma cell lines. Expressed in many hormone-independent mammary carcinoma cell lines.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

Listprice: €1,325.00

Price: €1,325.00

available

Quantity:

Compare

Add to wishlist