« Back
Home /
Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial

Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial

€1,783.00

Excl. VAT

Item no.	CSB-EP006163MO1-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Immunology
Target / Protein	Ctla4
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P09793
AA Sequence	EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVR VTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSG TFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYF VGMGNGTQIYVIDPEPCPDSD
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region	36-161aa
Protein Length	Extracellular Domain
MW	33.9 kDa
Alternative Name(s)	Cytotoxic T-lymphocyte-associated antigen 4
Relevance	Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28
Reference	CTLA-4 and CD28 activated lymphocyte molecules are closely related in both mouse and human as to sequence, message expression, gene structure, and chromosomal location. Harper K., Balzano C., Rouvier E., Mattei M.-G., Luciani M.-F., Golstein P. J. Immunol. 147:1037-1044(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Widely expressed with highest levels in lymphoid tissues.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

Listprice: €1,783.00

Price: €1,783.00

available

Quantity:

Compare

Add to wishlist