« Back
Home /
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

€2,345.00

Excl. VAT

Item no.	CSB-CF008532MO-100
Manufacturer	Cusabio
Amount	100ug
Category	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fc-epsilon RI-alpha
Available
Research Areas	Immunology
Target / Protein	Fcer1a
Biologically Active	Not Test
Expression System	in vitro E.coli expression system
Species of origin	Mus musculus (Mouse)
Uniprot ID	P20489
AA Sequence	ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMN STTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQ KQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFD IRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIRE ATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKC KYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVL EIQKTGKYKKVETELLT
Tag Info	N-terminal 10xHis-SUMO-tagged
Expression Region	24-250aa
Protein Length	Full Length of Mature Protein
MW	44.7 kDa
Alternative Name(s)	Fc-epsilon RI-alpha
Relevance	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Reference	Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation. Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P. Mamm. Genome 11:633-638(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Expressed in bone marrow mast cells, as well as in the pineal gland at night.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

Listprice: €2,345.00

Price: €2,345.00

available

Quantity:

Compare

Add to wishlist