- Die Vergleichsliste wurde geleert.

SUR2A

€491.00

Excl. VAT

Item no.	75-296
Manufacturer	Antibodies Incorporated
Amount	100 uL
Category	Antibodies Immunohistochemistry Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Applications	IHC, ICC, IB
Clone	N319A/14
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG2a
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Applications info	Immunoblot (IB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
Category Name	Receptors
ABID	RRID:AB_2315928
Cross Reactivity	Does not cross-react with SUR2B
Description	Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170) Rat: 97% identity (41/42 amino acids identical) Human: 92% identity (39/42 amino acids identical) 100% identity with SUR2C <50% identity with SUR2B
Expected Banding Pattern	120 kDa
Target	SUR2A
Validation	T\|Br-IB\|Br-IHC\|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

Listprice: €491.00

Price: €491.00

available

Delivery expected until 9/11/2025

Quantity:

Compare