« Back
Home /
Recombinant Human OSMR Protein

Recombinant Human OSMR Protein

€140.00

Excl. VAT

Item no.	RP00224-50ug
Manufacturer	Abclonal
Amount	50 ug
Category	Oncology Metabolism Diabetes Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines By Organ Skin Cancer Hepatic Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 92% by SDS-PAGE.
Sequence	ERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFS
NCBI	OSMR/IL-31RB
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL-31RB, OSMRB, PLCA1
Similar products	OSMRB, IL-31RB, PLCA1
Available
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Glu28-Ser739
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Interleukin
Gene Symbol	OSMR/IL-31RB
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human OSMR/IL-31RB Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu28-Ser739) of human OSMR (Accession #NP_003990) fused with a 6×His tag at the C-terminus.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

Listprice: €140.00

Price: €140.00

available

Delivery expected until 9/30/2025

Quantity:

Compare