Comparison

Recombinant SARS-CoV-2 Spike S1 Protein with Fc tag

€1,975.00
Excl. VAT
Item no. RP01279-1mg
Manufacturer Abclonal
Amount 1 mg
Category
Type Proteins Recombinant
Specific against SARS-CoV-2
Host SARS-CoV-2
Purity > 85% by SDS-PAGE.
Sequence VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
NCBI SARS-CoV-2 Spike S1
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Route
C-hFc
Manufacturers Category
Proteins
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Immunogen
Val16-Arg685
Storage
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. or This liquid product is stable at ≤ ‑70°C for up to 1 year from the date of receipt.|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Manufacturers Research Area
SARS-CoV-2 antigens
Gene Symbol
SARS-CoV-2 Spike S1
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant SARS-CoV-2 Spike S1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val16-Arg685) of sars-cov-2 Spike S1 (Accession #YP_009724390.1) fused with a Fc tag at the C-terminus.
Protein Bio Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ACE2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant SARS-CoV-2 Spike S1 Protein,the EC50 of Recombinant SARS-CoV-2 Spike S1 Protein is 47.35 ng/mL.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
Listprice: €1,975.00
Price: €1,975.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close