Comparison

CD30 Rabbit mAb

€125.00
Excl. VAT
Item no. A9789-20ul
Manufacturer Abclonal
Amount 20ul
Category
Type Antibody Monoclonal
Applications WB, IF, ICC, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence SPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NCBI TNFRSF8
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CD30, D1S166E, Ki-1
Available
Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Route
Synthetic Peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 496-595 of human CD30 (P28908).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:100 - 1:500|IF/ICC, 1:50 - 1:200
Protein Size
64kDa
Manufacturers Research Area
Cancer, Tumor immunology, Tumor biomarkers, Signal Transduction, PI3K-Akt Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, Cytokines, NF-kB Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, Stem Cells
Gene Symbol
TNFRSF8

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20ul
Available: In stock
Listprice: €125.00
Price: €125.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close