« Back
Home /
Cardiac troponin T (TNNT2) Rabbit mAb

Cardiac troponin T (TNNT2) Rabbit mAb

€125.00

Excl. VAT

Item no.	A4914-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Carcinoma Hematology Lymphoma Melanoma Sarcoma Cell Biology Cytoskeleton Western Blot Immunofluorescence Primary Antibodies Microfilaments
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	QKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
NCBI	TNNT2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CMD1D, CMH2, CMPD2, LVNC6, RCM3, TnTC, cTnT
Similar products	CMPD2, cTnT, CMH2, RCM3, TnTC, CMD1D, LVNC6
Available
Background	This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 199-298 of human Cardiac troponin T (TNNT2) (P45379).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:2000 - 1:5000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	36kDa
Manufacturers Research Area	Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Microfilaments, Stem Cells, Mesenchymal Stem Cells, Cardiovascular, Heart, Contractility
Gene Symbol	TNNT2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

Listprice: €125.00

Price: €125.00

available

Delivery expected until 9/2/2025

Quantity:

Compare