Comparison

SARS-CoV-2 Spike RBD (N501Y) Rabbit mAb

€2,340.00
Excl. VAT
Item no. A21254-1000uL
Manufacturer Abclonal
Amount 1000 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA
Specific against SARS-CoV-2
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence NYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG
NCBI SARS-CoV-2 Spike RBD (N51Y)
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias SARS-CoV-2 Spike RBD (N501Y)
Available
Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Route
Synthetic peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 450-550 of coronavirus SARS-CoV-2 Spike RBD (N501Y) (YP_009724390.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:1000 - 1:5000
Protein Size
141KD
Manufacturers Research Area
COVID - 19, SARS - CoV - 2, severe acute respiratory syndrome coronavirus
Gene Symbol
SARS-CoV-2 Spike RBD (N501Y)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
Listprice: €2,340.00
Price: €2,340.00
available

Delivery expected until 9/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close