« Back
Home /
HCoV-OC43 Nucleoprotein Rabbit pAb

HCoV-OC43 Nucleoprotein Rabbit pAb

€245.00

Excl. VAT

Item no.	A20610-100ul
Manufacturer	Abclonal
Amount	100ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	other
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	YWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRS
NCBI	HCoV-OC43 Nucleoprotein
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Background	Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus Nucleoprotein (YP_009555245.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	49kDa
Gene Symbol	HCoV-OC43 Nucleoprotein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ul

Listprice: €245.00

Price: €245.00

available

Delivery expected until 9/30/2025

Quantity:

Compare