« Back
Home /
TIM-3/HAVCR2 Rabbit pAb

TIM-3/HAVCR2 Rabbit pAb

€100.00

Excl. VAT

Item no.	A20495-20uL
Manufacturer	Abclonal
Amount	20 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTA
NCBI	Havcr2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Tim; TIM-; Tim3; Timd; TIM-3; Timd3
Available
Background	Predicted to enable metal ion binding activity. Involved in several processes, including regulation of cytokine production; regulation of leukocyte activation; and toll-like receptor signaling pathway. Located in cell surface; early endosome; and immunological synapse. Is expressed in several structures, including dorsal aorta; gut; liver; lung; and reproductive system. Human ortholog(s) of this gene implicated in hepatocellular carcinoma and renal cell carcinoma. Orthologous to human HAVCR2 (hepatitis A virus cellular receptor 2).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-193 of mouse TIM-3/HAVCR2 (NP_599011.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	31kDa
Gene Symbol	Havcr2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

Listprice: €100.00

Price: €100.00

available

Delivery expected until 9/30/2025

Quantity:

Compare