« Back
Home /
ENO2 Rabbit mAb

ENO2 Rabbit mAb

€125.00

Excl. VAT

Item no.	A19091-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies By Organ Lung Cancer Testicular & Prostate Cancer Stem Cell Markers
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	LELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANA
NCBI	ENO2
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ENO2;HEL-S-279;NSE;enolase 2
Similar products	NSE, ENO2, enolase 2, HEL-S-279
Available
Background	This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 47-100 of human ENO2 (NP_001966.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:2000 - 1:10000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	47kDa
Manufacturers Research Area	Cancer, Tumor biomarkers, Cell Biology Developmental Biology, Endocrine Metabolism, Carbohydrate metabolism, Neuroscience, Cell Type Marker, Stem Cells, Neuron marker
Gene Symbol	ENO2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

Listprice: €125.00

Price: €125.00

available

Delivery expected until 9/2/2025

Quantity:

Compare