« Back
Home /
Cytokeratin 14 (KRT14) Rabbit mAb

Cytokeratin 14 (KRT14) Rabbit mAb

€195.00

Excl. VAT

Item no.	A19039-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot Primary Antibodies Intermediate filaments
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	VGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHD
NCBI	KRT14
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CK14;EBS3;EBS4;K14;NFJ;Cytokeratin 14;KRT14
Similar products	KRT14, CK14, EBS3, EBS4, K14, NFJ, Cytokeratin 14
Available
Background	This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 264-457 of human Cytokeratin 14 (KRT14) (P02533).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	52kDa
Manufacturers Research Area	Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Intermediate Filaments, Extracellular Matrix, Keratin
Gene Symbol	KRT14

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

Listprice: €195.00

Price: €195.00

available

Delivery expected until 9/2/2025

Quantity:

Compare