« Back
Home /
[KO Validated] CD147/BSG Rabbit pAb

[KO Validated] CD147/BSG Rabbit pAb

€125.00

Excl. VAT

Item no.	A18032-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Neuroscience Neural Lineage Markers Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies Adhesion Molecule Markers
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL
NCBI	BSG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BSG;5F7;CD147;EMMPRIN;OK;TCSF;basigin
Similar products	CD147, BSG, 5F7, EMMPRIN, TCSF, OK, basigin
Available
Background	The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human CD147/CD147/BSG (NP_940991.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	42kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Cell Biology Developmental Biology, Extracellular Matrix, Endocrine Metabolism, Carbohydrate metabolism, Immunology Inflammation, CDs, Neuroscience, Cell Type Marker
Gene Symbol	BSG

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

Listprice: €125.00

Price: €125.00

available

Delivery expected until 9/30/2025

Quantity:

Compare